Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010178-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010178-M01, RRID:AB_606693
- Product name
- ODZ1 monoclonal antibody (M01), clone 3G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ODZ1.
- Antigen sequence
TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIA
RQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLL
STGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQS
EIGRR- Isotype
- IgG
- Antibody clone number
- 3G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references C-terminal region of teneurin-1 co-localizes with the dystroglycan complex in adult mouse testes and regulates testicular size and testosterone production.
C-terminal processing of the teneurin proteins: independent actions of a teneurin C-terminal associated peptide in hippocampal cells.
Chand D, Colacci M, Dixon K, Kollara A, Brown TJ, Lovejoy DA
Histochemistry and cell biology 2014 Feb;141(2):191-211
Histochemistry and cell biology 2014 Feb;141(2):191-211
C-terminal processing of the teneurin proteins: independent actions of a teneurin C-terminal associated peptide in hippocampal cells.
Chand D, Casatti CA, de Lannoy L, Song L, Kollara A, Barsyte-Lovejoy D, Brown TJ, Lovejoy DA
Molecular and cellular neurosciences 2013 Jan;52:38-50
Molecular and cellular neurosciences 2013 Jan;52:38-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ODZ1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
