HPA002848

TENM1 antibody from Atlas Antibodies
ODZ1, ODZ3, TEN-M1, TEN1, TNM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002848
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002848, RRID:AB_1079523
Product name
Anti-TENM1
Provider product page
Atlas Antibodies - HPA002848
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IRTISRNQAHLNDMNIYEIASPADQELYQFTVNGT
HLHTLNLITRDYVYNFTYNSEGDLGAITSSNGNSV
HIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVS
AQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDP
EGH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -