HPA002848

TENM1 antibody from Sigma-Aldrich
ODZ1, ODZ3, TEN-M1, TNM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002848
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002848, RRID:AB_1079523
Product name
Anti-ODZ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002848
Antibody type
Polyclonal
Antigen
Teneurin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IRTISRNQAHLNDMNIYEIASPADQELYQFTVNGT
HLHTLNLITRDYVYNFTYNSEGDLGAITSSNGNSV
HIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVS
AQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDP
EGH
Storage
-20C
Provider Type Product Number
- No reagents -