Antibody data

Product number
ABIN404811
Provider
antibodies-online
Product name
anti-General Transcription Factor IIH, Polypeptide 4, 52kDa (GTF2H4) antibody
Provider product page
antibodies-online - ABIN404811
Antibody type
Polyclonal
Antigen
The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4
Reactivity
Human, Mouse, Rat, Bovine, Porcine, Xenopus
Host
Rabbit
Antigen sequence
ESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYG
HPATC LAVFRELPSL
Vial size
50 µg
Provider Type Product Number
- No reagents -