Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R31632 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- Haptoglobin Antibody
- Antibody type
- Polyclonal
- Antigen
- An amino acid sequence from the middle region of human Haptoglobin (NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ) was used as the immunogen for this Haptoglobin antibody.
- Description
- Antigen affinity purified antibody
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- The lyophilized Haptoglobin antibody can be stored at 4°C to -20°C. After reconstitution, aliquot and store at -20°C. Avoid repeated freeze/thaws.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of Haptoglobin antibody and Lane 1: human HeLa; 2: (h) SMMC-7721; 3: mouse HEPA; 4: (h) HEPG2 lysate. Predicted molecular weight: ~38-45kDa (beta chain).
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of Haptoglobin antibody and recombinant human protein (0.5ng)
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- IHC-P: Haptoglobin antibody testing of human placenta tissue
