Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036516 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-SLCO4C1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AKGIENLAFVPSSPDILRRLSASPSQIEVSALSSD
PQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEE
KLRSLSLSEF- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The developmental programme for genesis of the entire kidney is recapitulated in Wilms tumour
Functional expression of the 11 human Organic Anion Transporting Polypeptides in insect cells reveals that sodium fluorescein is a general OATP substrate.
Long D, Fukuzawa R, Anaka M, Morison I, Reeve A
PLOS ONE 2017;12(10):e0186333
PLOS ONE 2017;12(10):e0186333
Functional expression of the 11 human Organic Anion Transporting Polypeptides in insect cells reveals that sodium fluorescein is a general OATP substrate.
Patik I, Kovacsics D, Német O, Gera M, Várady G, Stieger B, Hagenbuch B, Szakács G, Özvegy-Laczka C
Biochemical pharmacology 2015 Dec 15;98(4):649-58
Biochemical pharmacology 2015 Dec 15;98(4):649-58
No comments: Submit comment
No validations: Submit validation data