HPA003277

CUX1 antibody from Sigma-Aldrich
CASP, CDP, CDP/Cut, CDP/Cux, CDP1, Clox, CUT, CUTL1, CUX, Cux/CDP, GOLIM6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003277
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003277, RRID:AB_10601804
Product name
Anti-CUX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003277
Antibody type
Polyclonal
Antigen
cut-like homeobox 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYP
PLAISLKKPSAAPEAGASALPNPPALKKEAQDAPG
LDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWS
Storage
-20C
Provider Type Product Number
- No reagents -