HPA002913

GPM6B antibody from Atlas Antibodies
M6B, MGC17150, MGC54284
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002913
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002913, RRID:AB_2263553
Product name
Anti-GPM6B
Provider product page
Atlas Antibodies - HPA002913
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDI
RQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -