HPA002913

GPM6B antibody from Atlas Antibodies
M6B, MGC17150, MGC54284
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002913
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002913, RRID:AB_611530
Product name
Anti-GPM6B
Provider product page
Atlas Antibodies - HPA002913
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDI
RQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -