HPA002913

GPM6B antibody from Sigma-Aldrich
M6B, MGC17150, MGC54284
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002913
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002913, RRID:AB_2263553
Product name
Anti-GPM6B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002913
Antibody type
Polyclonal
Antigen
Neuronal membrane glycoprotein M6-b recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVPVFMFYNIWSTCEVIKSPQTNGTTGVEQICVDI
RQYGIIPWNAFPGKICGSALENICNTNEFYMSYH
Storage
-20C
Provider Type Product Number
- No reagents -