HPA010967

HLA-DQA2 antibody from Sigma-Aldrich
HLA-DXA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010967
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010967, RRID:AB_1853931
Product name
Anti-HLA-DQA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010967
Antibody type
Polyclonal
Antigen
HLA class II histocompatibility antigen, DQ(6) alpha chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLE
TKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEF
MMRQSNSTAATNEVPEVTVFSKFPVTLG
Storage
-20C
Provider Type Product Number
- No reagents -