HPA037751

FAM53B antibody from Atlas Antibodies
bA12J10.2, KIAA0140, smp
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037751
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037751, RRID:AB_2675645
Product name
Anti-FAM53B
Provider product page
Atlas Antibodies - HPA037751
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDR
WRDLDRKCPLQIDQPSTSIWECLPEKDSSLWHREA
VTACAVTSLIKDLSISDHNGNPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -