Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003109-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003109-M06, RRID:AB_1111894
- Product name
- HLA-DMB monoclonal antibody (M06), clone 5G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HLA-DMB.
- Antigen sequence
VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDP
EENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLR
NGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFN
TRE- Isotype
- IgG
- Antibody clone number
- 5G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HLA-DMB expression in transfected 293T cell line by HLA-DMB monoclonal antibody (M06), clone 5G11.Lane 1: HLA-DMB transfected lysate(28.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HLA-DMB on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HLA-DMB transfected lysate using anti-HLA-DMB monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HLA-DMB MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol