Antibody data

Product number
H00003109-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003109-M09, RRID:AB_1137255
Product name
HLA-DMB monoclonal antibody (M09), clone 6E10
Provider product page
Abnova Corporation - H00003109-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HLA-DMB.
Antigen sequence
VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDP
EENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLR
NGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFN
TRE
Isotype
IgG
Antibody clone number
6E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -