Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036703 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036703, RRID:AB_10672227
- Product name
- Anti-ZNRF3
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PNSSTSEVGLEASPGAAPDLRRTWKGGHELPSCAC
CCEPQPSPAGPSAGAAGSSTLFLGPHLYEGSGPAG
GEPQSGSSQGLYGLHPDHLPRTDGVKYEGLPCCFY
EEKQVAR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Low Protein Expression of both ATRX and ZNRF3 as Novel Negative Prognostic Markers of Adult Adrenocortical Carcinoma
Brondani V, Lacombe A, Mariani B, Montenegro L, Soares I, Bezerra-Neto J, Tanno F, Srougi V, Chambo J, Mendonca B, Almeida M, Zerbini M, Fragoso M
International Journal of Molecular Sciences 2021;22(3):1238
International Journal of Molecular Sciences 2021;22(3):1238
No comments: Submit comment
No validations: Submit validation data