ABIN631903

antibody from antibodies-online

Targeting: C21orf91 C21orf14, C21orf38, CSSG1, EURL, YG81

Western blot

Antibody data

Submit

Validation data

Product number: ABIN631903 - Provider product page
Provider: antibodies-online
Product name: anti-Chromosome 21 Open Reading Frame 91 (C21orf91) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: C21 ORF91 antibody was raised using the middle region of C21 rf91 corresponding to a region with amino acids LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

C21orf91 protein structure - ABIN631903 shown in red.