HPA018288

C21orf91 antibody from Sigma-Aldrich
C21orf14, C21orf38, CSSG1, EURL, YG81
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018288
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018288, RRID:AB_1845710
Product name
Anti-C21orf91 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018288
Antibody type
Polyclonal
Antigen
Protein EURL homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHY
SREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQV
QEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRT
GMKSHLP
Storage
-20C
Provider Type Product Number
- No reagents -