Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008908-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008908-M04, RRID:AB_565794
- Product name
- GYG2 monoclonal antibody (M04), clone 3D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GYG2.
- Antigen sequence
CDPLSQPSPQPADFTETETILQPANKVESVSSEET
FEPSQELPAEALRDPSLQDALEVDLAVSVSQISIE
EKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKL
DRFLQ- Isotype
- IgG
- Antibody clone number
- 3D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references LC-MS/MS characterization of combined glycogenin-1 and glycogenin-2 enzymatic activities reveals their self-glucosylation preferences.
Nilsson J, Halim A, Larsson E, Moslemi AR, Oldfors A, Larson G, Nilsson J
Biochimica et biophysica acta 2014 Feb;1844(2):398-405
Biochimica et biophysica acta 2014 Feb;1844(2):398-405
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GYG2 expression in transfected 293T cell line by GYG2 monoclonal antibody (M04), clone 3D10.Lane 1: GYG2 transfected lysate(55.212 KDa).Lane 2: Non-transfected lysate.