HPA005495

GYG2 antibody from Sigma-Aldrich
GN-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005495
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005495, RRID:AB_1079035
Product name
Anti-GYG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005495
Antibody type
Polyclonal
Antigen
Glycogenin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLE
QGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQAG
EARASPGHTLCHSDVGGPCADSASGVGEPCENSTP
SAGVPCANSPLGSNQPAQGLPEPTQIVDETLSL
Storage
-20C
Provider Type Product Number
- No reagents -