PAB23437
antibody from Abnova Corporation
Targeting: KNDC1
bB439H18.3, C10orf23, FLJ25027, KIAA1768, RASGEF2, v-KIND, Very-KIND
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB23437 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB23437, RRID:AB_11122984
- Product name
- KNDC1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant KNDC1.
- Antigen sequence
AHRWSKLRNIAKVVSQVHAFQENPYTFSPDPKLQS
YLKQRIARFSGADISTLAADSRANFHQVSSEKHSR
K- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate with KNDC1 polyclonal antibody (Cat # PAB23437) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)