HPA035376
antibody from Atlas Antibodies
Targeting: NDUFAF3
2P1, C3orf60, DKFZP564J0123, E3-3, MGC10527
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [10]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035376 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035376, RRID:AB_2674597
- Product name
- Anti-NDUFAF3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ADDELYQRTRISLLQREAAQAMYIDSYNSRGFMIN
GNRVLGPCALLPHSVVQWNVGSHQDITEDSF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube, kidney, prostate and testis using Anti-NDUFAF3 antibody HPA035376 (A) shows similar protein distribution across tissues to independent antibody HPA035377 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in with a granular pattern in cells in seminiferous ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder using Anti-NDUFAF3 antibody HPA035376.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-NDUFAF3 antibody HPA035376.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-NDUFAF3 antibody HPA035376.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-NDUFAF3 antibody HPA035376.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN