Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008712-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008712-B01, RRID:AB_1114689
- Product name
- PAGE1 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Antigen
- PAGE1 (NP_003776.2, 1 a.a. ~ 146 a.a) full-length human protein.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MGFLRRLIYRRRPMIYVESSEESSDEQPDEVESPT
QSQDSTPAEEREDEGASAAQGQEPEADSQELVQPK
TGCELGDGPDTKRVCLRNEEQMKLPAEGPEPEADS
QEQVHPKTGCERGDGPDVQELGLPNPEEVKTPEED
EGQSQP- Vial size
- 50 μl
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PAGE1 expression in transfected 293T cell line (H00008712-T01) by PAGE1 MaxPab polyclonal antibody.Lane 1: PAGE1 transfected lysate(16.06 KDa).Lane 2: Non-transfected lysate.
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to PAGE1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol