HPA003473

PAGE1 antibody from Sigma-Aldrich
CT16.3, GAGE-9, GAGEB1, PAGE-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003473
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003473, RRID:AB_1079558
Product name
Anti-PAGE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003473
Antibody type
Polyclonal
Antigen
G antigen family B member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EESSDEQPDEVESPTQSQDSTPAEEREDEGASAAQ
GQEPEADSQELVQPKTGCELGDGPDTKRVCLRNEE
QMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQE
LGLPNPEEVKTPEEDE
Storage
-20C
Provider Type Product Number
- No reagents -