HPA039082

ACRBP antibody from Atlas Antibodies
CT23, OY-TES-1, SP32

Antibody data

Product number
HPA039082
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039082, RRID:AB_10671036
Product name
Anti-ACRBP
Provider product page
Atlas Antibodies - HPA039082
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSP
ISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLG
GQEQAPEHKQEQGVEHRQEPTQEHKQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.