HPA041302

antibody from Atlas Antibodies

Targeting: CORO2A IR10, WDR2

Antibody data

Submit

Validation data

Product number: HPA041302 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041302, RRID:AB_10794195
Product name: Anti-CORO2A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: WRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFE CPPPKTENELLQMFYRQQEEIRRLRELLTQREVQA KQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CORO2A protein structure - HPA041302 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and kidney tissues using Anti-CORO2A antibody. Corresponding CORO2A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, lymph node, small intestine and testis using Anti-CORO2A antibody HPA041302 (A) shows similar protein distribution across tissues to independent antibody HPA041161 (B).
Antibody #2 product nr: HPA041161
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-CORO2A antibody HPA041302.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CORO2A antibody HPA041302.
Sample type: HUMAN