Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009130-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009130-M02, RRID:AB_530039
- Product name
- FAM50A monoclonal antibody (M02), clone 5F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FAM50A.
- Antigen sequence
MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRI
AEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTL
NDMKAKQEALVKEREKQL- Isotype
- IgG
- Antibody clone number
- 5F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FAM50A monoclonal antibody (M02), clone 5F10 Western Blot analysis of FAM50A expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FAM50A monoclonal antibody (M02), clone 5F10. Western Blot analysis of FAM50A expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FAM50A is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to FAM50A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol