HPA003585

FAM50A antibody from Atlas Antibodies
9F, DXS9928E, HXC-26, XAP5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003585
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003585, RRID:AB_611477
Product name
Anti-FAM50A
Provider product page
Atlas Antibodies - HPA003585
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLE
KLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEA
AMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDR
E
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -