HPA003440

CHCHD10 antibody from Atlas Antibodies
C22orf16, MIX17A, N27C7-4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003440
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003440, RRID:AB_1078348
Product name
Anti-CHCHD10
Provider product page
Atlas Antibodies - HPA003440
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGS
SEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDC
STTQSDLSLCEGFSEALKQCKYYHGLSSLP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -