Antibody data

Product number
HPA003904
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003904, RRID:AB_1079853
Product name
Anti-RPS6KA6
Provider product page
Atlas Antibodies - HPA003904
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YTMLAGYTPFANGPNDTPEEILLRIGNGKFSLSGG
NWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSW
ITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHK
TF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.