HPA002852

RPS6KA6 antibody from Sigma-Aldrich
RSK4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002852
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002852, RRID:AB_1079854
Product name
Anti-RPS6KA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002852
Antibody type
Polyclonal
Antigen
Ribosomal protein S6 kinase alpha-6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASAN
AHQLFKGFSFVATSIAEEYKITPITSANVLPIVQI
NGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNM
EFAVKIIDKSK
Storage
-20C
Provider Type Product Number
- No reagents -