H00348013-B01P

TMEM255B antibody from Abnova Corporation
FAM70B, MGC20579
No application information provided.

Antibody data

Product number
H00348013-B01P
Provider
Abnova Corporation
Product name
FAM70B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00348013-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FAM70B protein.
Antigen sequence
MQPPVPGPLGLLDPAEGLSRRKKTSLWFVGSLLLV
SVLIVTVGLAATTRTENVTVGGYYPGIILGFGSFL
GIIGINLVENRRQMLVAAIVFISFGVVAAFCCAIV
DGVFAAQHIEPRPLTTGRCQFYSSGVGYLYDVYQT
EVTCHSLDGKCQLKVRSNTCYCCDLYACGSAEPSP
AYYEFIGVSGCQDVLHLYRLLWASAVLNVLGLFLG
IITAAVLGAFKDMVPLSQLAYGPAVPPQTLYNPAQ
QILAYAGFRLTPEPVPTCSSYPLPLQPCSRFPVAP
SSALASSEDLQPPSPSSSGSGLPGQAPPCYAPTYF
PPGEKPPPYAP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.