HPA044593

ACSM6 antibody from Atlas Antibodies
bA310E22.3, C10orf129

Antibody data

Product number
HPA044593
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA044593, RRID:AB_10960261
Product name
Anti-ACSM6
Provider product page
Atlas Antibodies - HPA044593
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TFCPETVLNVLSRFPITTLSANPEMYQELLQHKCF
TSYRFKSLKQCVAAGGPISPGVIEDWKRITKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.