PAB24344

ACSM6 antibody from Abnova Corporation
bA310E22.3, C10orf129

Antibody data

Product number
PAB24344
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB24344, RRID:AB_11122174
Product name
C10orf129 polyclonal antibody
Provider product page
Abnova Corporation - PAB24344
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C10orf129.
Antigen sequence
TFCPETVLNVLSRFPITTLSANPEMYQELLQHKCF
TSYRFKSLKQCVAAGGPISPGVIEDWKRITKL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.