Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000633 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000633, RRID:AB_1079538
- Product name
- Anti-OTX2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMT
YTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLP
GPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSL
GFNSTTDCLDYKDQTASWKLNFNADCLDYK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Stem cells from human exfoliated deciduous tooth exhibit stromal-derived inducing activity and lead to generation of neural crest cells from human embryonic stem cells.
Differential CRX and OTX2 expression in human retina and retinoblastoma.
Karbalaie K, Tanhaei S, Rabiei F, Kiani-Esfahani A, Masoudi NS, Nasr-Esfahani MH, Baharvand H
Cell journal 2015 Spring;17(1):37-48
Cell journal 2015 Spring;17(1):37-48
Differential CRX and OTX2 expression in human retina and retinoblastoma.
Glubrecht DD, Kim JH, Russell L, Bamforth JS, Godbout R
Journal of neurochemistry 2009 Oct;111(1):250-63
Journal of neurochemistry 2009 Oct;111(1):250-63
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows moderate nuclear positivity in neuronal cells.
- Sample type
- HUMAN