HPA002853

ALG13 antibody from Atlas Antibodies
CXorf45, FLJ23018, GLT28D1, MDS031, TDRD13, YGL047W
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002853
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002853, RRID:AB_611517
Product name
Anti-ALG13
Provider product page
Atlas Antibodies - HPA002853
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIG
RGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLV
ISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLEL
AKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPP
G
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -