HPA037510

POC5 antibody from Atlas Antibodies
C5orf37, FLJ35779, hPOC5, MGC120442, MGC120443, MGC120444
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037510
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037510, RRID:AB_10672349
Product name
Anti-POC5
Provider product page
Atlas Antibodies - HPA037510
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DVVERACQARAEEVCIQISNDYEAKVAMLSGALEN
AKAEIQRMQHEKEHFEDSMKKAFMRGVCALNLEAM
TIFQNRNDAGIDSTNNKKEEYGPGVQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -