PAB23124

POC5 antibody from Abnova Corporation
C5orf37, FLJ35779, hPOC5, MGC120442, MGC120443, MGC120444

Antibody data

Product number
PAB23124
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23124, RRID:AB_11131624
Product name
C5orf37 polyclonal antibody
Provider product page
Abnova Corporation - PAB23124
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C5orf37.
Antigen sequence
DVVERACQARAEEVCIQISNDYEAKVAMLSGALEN
AKAEIQRMQHEKEHFEDSMKKAFMRGVCALNLEAM
TIFQNRNDAGIDSTNNKKEEYGPGVQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -