Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA046205 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA046205, RRID:AB_10965325
- Product name
- Anti-KATNAL1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAHP
ISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDG
EMPKFDGAGYDKDL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The Aneugenicity of Ketone Bodies in Colon Epithelial Cells Is Mediated by Microtubule Hyperacetylation and Is Blocked by Resveratrol
The mitotic tensegrity guardian tau protects mammary epithelia from katanin-like1-induced aneuploidy
Sudo H, Kubo A
International Journal of Molecular Sciences 2021;22(17):9397
International Journal of Molecular Sciences 2021;22(17):9397
The mitotic tensegrity guardian tau protects mammary epithelia from katanin-like1-induced aneuploidy
Sudo H, Nakajima K
Oncotarget 2016;7(33):53712-53734
Oncotarget 2016;7(33):53712-53734
No comments: Submit comment
No validations: Submit validation data