AMAb90803

PGAM5 antibody from Atlas Antibodies
BXLBv68, MGC5352
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
AMAb90803
Provider
Atlas Antibodies
Product name
Anti-PGAM5
Provider product page
Atlas Antibodies - AMAb90803
Antibody type
Monoclonal
Description
Protein A purified
Reactivity
Human
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
NWDRREPLSLINVRKRNVESGEEELASKLDHYKAK
ATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAEL
TGLRLASLGLKFNKIV
Epitope
Binds to an epitope located within the peptide sequence NWDRREPLSLINVRK as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL0624
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -