HPA016656

SALL3 antibody from Sigma-Aldrich
ZNF796
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016656
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016656, RRID:AB_1856546
Product name
Anti-SALL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016656
Antibody type
Polyclonal
Antigen
Sal-like protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYDDKNAETLSSYDDDMDENSMEDDAELKDAATDP
AKPLLSYAGSCPPSPPSVISSIAALENQMKMIDSV
MSCQQLTGLKSVENGSGE
Storage
-20C
Provider Type Product Number
- No reagents -