HPA003231

CHM antibody from Sigma-Aldrich
DXS540, REP-1, TCD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003231
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003231, RRID:AB_1078518
Product name
Anti-CHM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003231
Antibody type
Polyclonal
Antigen
Rab proteins geranylgeranyltransferase component A 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRKDKTIQHVEVFCYASQDLHEDVEEAGALQKNHA
LVTSANSTEAADSAFLPTEDESLSTMSCEMLTEQT
PSSDPENALEVNGAEVTGEKENHCDDKTCVPSTSA
EDMSENVPIAEDTTEQPKKNRITYSQIIKEG
Storage
-20C
Provider Type Product Number
- No reagents -