HPA014702

ZDHHC20 antibody from Sigma-Aldrich
FLJ25952
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014702
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014702, RRID:AB_1859001
Product name
Anti-ZDHHC20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014702
Antibody type
Polyclonal
Antigen
Palmitoyltransferase ZDHHC20, probable recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGS
NQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKS
GTNNHVTVAIE
Storage
-20C
Provider Type Product Number
- No reagents -