HPA002918

ITM2A antibody from Sigma-Aldrich
BRICD2A, E25A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002918
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002918, RRID:AB_1079159
Product name
Anti-ITM2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002918
Antibody type
Polyclonal
Antigen
Integral membrane protein 2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEADIREDDNIAIIDVPVPSFSDSDPAAIIHDFEK
GMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGK
LASGRYLPQTYVVREDLVAVEEIRDVSNLGIFIYQ
LCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPN
EFIVETK
Storage
-20C
Provider Type Product Number
- No reagents -