HPA002919

OPHN1 antibody from Sigma-Aldrich
ARHGAP41, MRX60, OPN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002919, RRID:AB_1079526
Product name
Anti-OPHN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002919
Antibody type
Polyclonal
Antigen
Oligophrenin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVTARRHKPITISKRLLRERTVFYTSSLDESEDEI
QHQTPNGTITSSIEPPKPPQHPKLPIQRSGETDPG
RKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKI
TPK
Storage
-20C
Provider Type Product Number
- No reagents -