HPA032099

UHRF1BP1 antibody from Atlas Antibodies
C6orf107, dJ349A12.1, FLJ20302, ICBP90
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA032099
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA032099, RRID:AB_10663289
Product name
Anti-UHRF1BP1
Provider product page
Atlas Antibodies - HPA032099
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RETAVNGQGELIPLKNIEGELSSAIHMTKDATKEA
LHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLS
LP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -