WH0001018M1

TEN1 antibody from MilliporeSigma / Merck KGaA
C17orf106, FLJ39785
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0001018M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-CDK3 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0001018M1
Antibody type
Monoclonal
Antigen
CDK3 (NP_001249, a.a. 206-305) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRI
TAKTALAHPYFSSPEPSPAARQYVLQRFRH (wit
hout GST)
Isotype
IgG
Storage
-20C