Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA043486 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TEN1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLY
DMIQSRVTLMAQHGSDQHQVLVCTK- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Structural and functional analysis of an OB-fold in human Ctc1 implicated in telomere maintenance and bone marrow syndromes
Shastrula P, Rice C, Wang Z, Lieberman P, Skordalakes E
Nucleic Acids Research 2018;46(2):972-984
Nucleic Acids Research 2018;46(2):972-984
No comments: Submit comment
No validations: Submit validation data