HPA065069

TEN1 antibody from Atlas Antibodies
C17orf106, FLJ39785

Antibody data

Product number
HPA065069
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA065069, RRID:AB_2685418
Product name
Anti-TEN1
Provider product page
Atlas Antibodies - HPA065069
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVL
TCVEGMNLPLLEQAIREQRLYKQER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.