HPA018334

URB1 antibody from Sigma-Aldrich
C21orf108, KIAA0539, NPA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018334
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018334, RRID:AB_1856088
Product name
Anti-URB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018334
Antibody type
Polyclonal
Antigen
Nucleolar pre-ribosomal-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VEHHKTCRSLGRSLWQQPSVGDILRLLDRDRMMQT
ILHFPQNRRLLPPEDTQELIFKDKSRVDLDGLYDP
CFLLQLFSELTRPEFVVDCRKFLDSNALGLTVTAL
SSYDP
Storage
-20C
Provider Type Product Number
- No reagents -