Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039612 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-C11orf63
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGP
RRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKR
GESHPEQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Disruption of the mouse Jhy gene causes abnormal ciliary microtubule patterning and juvenile hydrocephalus
Appelbe O, Bollman B, Attarwala A, Triebes L, Muniz-Talavera H, Curry D, Schmidt J
Developmental Biology 2013;382(1):172-185
Developmental Biology 2013;382(1):172-185
No comments: Submit comment
No validations: Submit validation data