Antibody data

Product number
H00005716-M19
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005716-M19, RRID:AB_1579272
Product name
PSMD10 monoclonal antibody (M19), clone 3F10
Provider product page
Abnova Corporation - H00005716-M19
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PSMD10.
Antigen sequence
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATR
TDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD
DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQN
GCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA
TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTP
LHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ
VAKGGLGLILKRMVEG
Isotype
IgG
Antibody clone number
3F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -